PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Gh_D07G0167
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Malvales; Malvaceae; Malvoideae; Gossypium
Family Trihelix
Protein Properties Length: 593aa    MW: 66720.5 Da    PI: 7.3584
Description Trihelix family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Gh_D07G0167genomeNAU-NBIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1trihelix90.81.4e-28409492185
     trihelix   1 rWtkqevlaLiearremeerlrrgklkkplWeevskkmrergferspkqCkekwenlnkrykkikegekkrtsessstcpyfdql 85 
                  rW+  ev aLi++r ++e+++r+  lk+p We+vs+ m++ g++rs+k+Ckekwen+nk+++k ke+ kkr s++s+tc+yfdql
  Gh_D07G0167 409 RWPIAEVEALIQVRCDLESKFREPGLKGPVWEQVSSLMSSFGYQRSAKKCKEKWENINKYFRKSKENGKKR-SQQSKTCSYFDQL 492
                  8********************************************************************98.78889*******9 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS500906.411406466IPR017877Myb-like domain
PfamPF138372.3E-20408494No hitNo description
CDDcd122031.27E-24408473No hitNo description
Sequence ? help Back to Top
Protein Sequence    Length: 593 aa     Download sequence    Send to blast
MHPIKYGAHH HHHHHHLQQQ QFMEDDDASS SASIFFISNP HNHQQQPVFP YPLHSQQHNK  60
QHENPVTHQL FHHQFQPFQH PESVHHHNQQ QPFLAVNFKL GLNENSGKKE AALPLNPQQN  120
GATFLHGNEQ QQQHSLFLPR CLPPQEDSPI KEPFWKPLNR LDNRQCSADG AKMVEGTKYN  180
KVLQQPGQST SVRSRNLDSK YGLFGELEAI YGLGKRGEAA QAGSGSALTG ENSPANVGPS  240
MNLTKFQEHD VVGANGGGGN VVATGVDHGS EASIGKEASL RKVQKKKRKM KMKEQLSSMV  300
VAFESLVKQV TDHQECLHKR FLEFIERMDK ERSVKEESWR QQEAEKRNRE AVARAHEQAL  360
ASSREALIVS YLEKITGESI NLPGKTPLLQ QPGNAMEPFN GVKVDNSSRW PIAEVEALIQ  420
VRCDLESKFR EPGLKGPVWE QVSSLMSSFG YQRSAKKCKE KWENINKYFR KSKENGKKRS  480
QQSKTCSYFD QLGQLYSRIP ITCPTSPTPL INSDIEVQKQ GDSDFLEAYI PERDLVTAQV  540
NISGNLKDSG MNIPKLDFDG IVGENVAQGS KVKYNESHES ELDGDDNDSD KGE
Nucleic Localization Signal ? help Back to Top
NLS
No. Start End Sequence
1279288LRKVQKKKRK
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_012487856.10.0PREDICTED: trihelix transcription factor GTL1-like
TrEMBLA0A0D2N4K80.0A0A0D2N4K8_G
STRINGPOPTR_0018s05520.11e-143(Populus trichocarpa)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MalvidsOGEM16469813
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G76890.29e-48Trihelix family protein